site stats

Tmem63a antibody

WebTMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. Sequence Synthetic peptide located within the following region: FLVLLLTILVCLAHTCFGCFKHLSPLNYKTEEPASDKGSEAEAHMPPPFT Physical form Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. …

The Cation Channel TMEM63B Is an Osmosensor Required for …

WebThis antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients … WebImmunohistochemistry of paraffin-embedded stromal tumor tissue slide using 12652-1-AP ( TMEM16A/DOG1 antibody at dilution of 1:50 (under 40x lens). Product Details Product Specific Information This antibody can recognize isoform1 and isoform2 of human ANO1. mel pet and co https://recyclellite.com

以精神行为异常为首发表现的脊髓亚急性联合变性1例_参考网

WebAnti-TMEM63A antibody produced in rabbit Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody View Price and Availability Sigma-Aldrich 150339 2-Chloropyridine-3-carboxylic acid 99% View Price and Availability Sigma-Aldrich N8161 NS309 ≥98% (HPLC), solid View Price and Availability Sigma-Aldrich SAB4700307 WebAbcam - antibodies and reagents supplier, find any antibody Hello. We're improving abcam.com and we'd welcome your feedback. ... Anti-TMEM63A antibody (ab221878) … WebJul 12, 2024 · TMEM63A Expression is Increased in the Neuromas of Patients The three members of the TMEM63 family are TMEM63A, TMEM63B, and TMEM63C, all of which … nas and r kelly street dreams

TMEM63A Antibody (NBP1-69249): Novus Biologicals

Category:TMEM16A/DOG1 Polyclonal Antibody (12652-1-AP) - Thermo Fisher Scientific

Tags:Tmem63a antibody

Tmem63a antibody

ZFIN Gene: tmem63a - Zebrafish Information Network

WebEnhanced - Independent antibodies i This method is based on comparing the staining pattern using two independent antibodies with no overlapping epitopes. A similar staining … WebProduct name Anti-TMEM63A antibody Description Rabbit polyclonal to TMEM63A Host species Rabbit Tested applications Suitable for: ICC/IF more details Species reactivity …

Tmem63a antibody

Did you know?

WebPrimary Antibodies Triple A Polyclonals Anti-TMEM63A Polyclonal Anti-TMEM63A Antibody transmembrane protein 63A References (1) Recommended Applications Product Description Polyclonal Antibody against Human TMEM63A Alternative Gene Names KIAA0792 Open Datasheet Price $505.00 Product Number HPA068918 Unit Size Concentration 0.1 mg/ml … WebTMEM63A Antibody Summary. Immunogen. This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: …

WebTMEM63A Antibody - C-terminal region (ARP40785_P050), Catalog ARP40785_P050. Tested in WB applications. Reacts with Human, Mouse, Rat, Cow, Horse, Rabbit samples. Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% suc WebTMEM63A. General description of the gene and the encoded protein (s) using information from HGNC and Ensembl, as well as predictions made by the Human Protein Atlas project. Official gene symbol, which is typically a short form of the gene name, according to HGNC. Full gene name according to HGNC.

WebMay 5, 2024 · TMEM63B is enriched in the inner ear sensory hair cells. Genetic deletion of TMEM63B results in necroptosis of outer hair cells (OHCs) and progressive hearing loss. … WebThis antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies. All characterization data for ENSG00000196187 on the Human Protein …

WebTMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown. Sequence Synthetic peptide …

WebTMEM63A antibody (ABIN2779067). Validated for WB. Tested in Cow, Horse, Human. Order online. English ... Comparison List Basket Phone: +1 877 302 8632 Fax: +1 888 205 9894 (Toll-free) E-Mail: [email protected]. Home Antibodies ELISA Kits Primary Antibodies. Monoclonal Antibodies; Polyclonal Antibodies; Recombinant Antibodies ... nas and slick rickWebAbcam - antibodies and reagents supplier, find any antibody Hello. We're improving abcam.com and we'd welcome your feedback. ... Anti-TMEM63A antibody (ab221878) Description: Rabbit polyclonal to TMEM63A. Application: ICC/IF. Reactivity: Human (predicted: Mouse, Rat, Orangutan) Conjugate: Unconjugated. nas and r kelly songsWebTMEM63A antibody (ABIN2779066). Validated for WB. Tested in Guinea Pig, Human, Mouse. Order online. English ... Comparison List Basket Phone: +1 877 302 8632 Fax: +1 888 205 9894 (Toll-free) E-Mail: [email protected]. Home Antibodies ELISA Kits Primary Antibodies. Monoclonal Antibodies; Polyclonal Antibodies; Recombinant … nas and the game hustlersWebTMEM63A. General description of the gene and the encoded protein (s) using information from HGNC and Ensembl, as well as predictions made by the Human Protein Atlas project. Official gene symbol, which is typically a short form of the gene name, according to HGNC. Full gene name according to HGNC. melphalan flufenamide withdrawnWeblnc-TMEM63A-2 in the GeneCaRNA (GeneCards ncRNA compendium) hub on the UCSC Golden Path. lnc-TMEM63A-2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different) nas and soulja boyWebTMEM63A Antibody (Cat. No. 25-646) can be used to detect Human TMEM63A Antibody in ELISA and WB. nas and scarface hip hop downloadWebPROTEIN SUMMARY SECTION OVERVIEW RNA DATA ANTIBODY DATA. TMEM63A INFORMATION. Proteini. Full gene name according to HGNC. Transmembrane protein … mel perth flights